PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016506815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 345aa    MW: 39155.6 Da    PI: 8.4723
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016506815.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP135.83.9e-421022432131
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt.......ssssasec.....eaesssssasn 84 
                     a kkdrhski T+ g+RdRR+Rls+++a++fF Lqd LGfdk+skt+eWLl+++k ai el+++       +ss+ sec      +es   ++ +
  XP_016506815.1 102 AYKKDRHSKINTAHGPRDRRMRLSLDVARKFFNLQDLLGFDKASKTVEWLLTKSKSAINELVQStatgaisTSSTTSECevisgIDESTTTNDIQ 196
                     679*************************************************************8887776444446776665422222222223 PP

             TCP  85 sssgkaaksaakskksqksaasalnlakesrakarararertrekmr 131
                     ++ ++++  ++k+ ++ ++ a+++ +akesr++arararert+ k++
  XP_016506815.1 197 KQPNRSKVGEKKKANKLARRAAFNPVAKESRKQARARARERTKIKKS 243
                     3334666666677777777777899999**************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.8E-44104242IPR005333Transcription factor, TCP
PROSITE profilePS5136935.634104162IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.477224241IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048831Biological Processregulation of shoot system development
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MYPSSNICNY NPNISSSNNL FHIPSPNSMQ YEHELFQYFH DHHLLQPQQQ QLLLTTPDHY  60
MAADSNKDTV ISSTINQLEG PKEVELQGSC KNKNGENKRA VAYKKDRHSK INTAHGPRDR  120
RMRLSLDVAR KFFNLQDLLG FDKASKTVEW LLTKSKSAIN ELVQSTATGA ISTSSTTSEC  180
EVISGIDEST TTNDIQKQPN RSKVGEKKKA NKLARRAAFN PVAKESRKQA RARARERTKI  240
KKSLLNIGDQ SMAADDLKRL GCWSPFETGE ESGIQGYSTN HQVEDQHTTN HEEHLLGTKE  300
NVDGCNLVVT GNWNPFTIFN YHHNTEISHE QQFTNFQFSG KFWEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1949530.0FJ194953.1 Nicotiana tabacum TCP1 protein-like gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016506815.10.0PREDICTED: transcription factor DICHOTOMA-like
TrEMBLG0ZGI81e-100G0ZGI8_PETHY; Putative transcription factor (Fragment)
STRINGPGSC0003DMT4000145721e-82(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24822256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-26TCP domain protein 12